Skip to Content
Merck
All Photos(2)

Key Documents

AV33096

Sigma-Aldrich

Anti-HSPA1A antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Heat shock 70 kDa protein 1A

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
HUF 131,000.00

HUF 131,000.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
HUF 131,000.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

HUF 131,000.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

52 kDa

species reactivity

bovine, goat, guinea pig, dog, human, sheep, rat, horse, rabbit, mouse
bovine, goat, human, dog, guinea pig, sheep, rat, horse, mouse, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HSPA1A(3303)

General description

Heat shock 70 kDa protein 1A (HSPA1A, eHSP70, HSP72) is an environmental stress-inducible extracellular/plasma circulating heat shock protein that interacts with effector cells of the innate immune system. HSPA1A promotes the proliferation of H22 hepatocarcinoma cells through TLR2 and TLR4 signaling. HSPAIA signaling via TLR4 may trigger O3-induced lung inflammation. HSPA1A and its in vivo antibodies may contribute to the development of atherosclerosis. HSPA1A may stimulate innate and adaptive proinflammatory immune responses.

Specificity

Rabbit polyclonal anti- HSPA1A antibody reacts with zebrafish, human, mouse, rat, Caenorhabditis elegans, and canine plasma circulating 70 kDa heat shock proteins.

Immunogen

Synthetic peptide directed towards the middle region of human HSPA1A

Application

Rabbit polyclonal anti- HSPA1A antibody is used to tag plasma circulating 70 kDa heat shock protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of plasma circulating 70 kDa heat shock proteins in the activation of cells containing TLR2 and TLR4 receptors, the stimulation of proinflammatory immune responses and the development of atherosclerosis.

Biochem/physiol Actions

HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.

Sequence

Synthetic peptide located within the following region: SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Megan K Elder et al.
Communications biology, 4(1), 823-823 (2021-07-02)
Alzheimer's disease (AD) is an age-related neurodegenerative disorder associated with memory loss, but the AD-associated neuropathological changes begin years before memory impairments. Investigation of the early molecular abnormalities in AD might offer innovative opportunities to target memory impairment prior to
Feng Li et al.
Molecules (Basel, Switzerland), 25(21) (2020-11-05)
Andrographolide is a labdene diterpenoid with potential applications against a number of viruses, including the mosquito-transmitted dengue virus (DENV). In this study, we evaluated the anti-viral activity of three 14-aryloxy analogues (ZAD-1 to ZAD-3) of andrographolide against Zika virus (ZIKV)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service