ELF1 is known to function as a transcription factor that regulates the Tie2 gene during blood vessel development. Elf1 has also been implicated in the regulation of terminal transferase gene. Rabbit Anti-ELF1 (AB2) antibody recognizes rat, human, bovine, canine, and mouse ELF1.
Immunogen
Synthetic peptide directed towards the N terminal region of human ELF1
Application
Rabbit Anti-ELF1 (AB2) antibody is suitable for use in western blot (1μg/ml) applications.
Biochem/physiol Actions
ELF1 belongs to the ETS family. It contains 1 ETS DNA-binding domain. ELF1 is a transcription factor that activates the LYN and BLK promoters. It appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. ELF1 binds specifically to two purine-rich motifs in the HIV-2 enhancer.
Sequence
Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Molecular and cellular biology, 16(11), 6121-6131 (1996-11-01)
The terminal deoxynucleotidyltransferase (TdT) gene represents an attractive model for the analysis of gene regulation during an early phase of lymphocyte development. In previous studies, we identified a DNA element, termed D', which is essential for TdT promoter activity in
Vascular development requires the tightly coordinated expression of several growth factors and their receptors. Among these are the Tie1 and Tie2 receptors, which are almost exclusively endothelial cell-specific. The critical transcriptional regulators of vascular-specific gene expression remain largely unknown. The
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.