AV13073

Anti-HTR1F antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-5-Hydroxytryptamine (serotonin) receptor 1F
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 42 kDa
• species reactivity: bovine, rabbit, rat, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_000857
• UniProt accession no.: P30939
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HTR1F(3355)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human HTR1F

Application

Anti-HTR1F antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

HTR1F is a post-synaptic 5-hydroxytryptamine (5-HT) receptor important in serotonergic functions. It negatively regulates 5-HT neuronal activity and has been implicated in mood regulation and responses to stress and emotions.

Sequence

Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable