Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

WH0010461M1

Sigma-Aldrich

Monoclonal Anti-MERTK antibody produced in mouse

clone 2D2, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-MER, Anti-c-mer proto-oncogene tyrosine kinase, Anti-cmer

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2D2, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MERTK(10461)

Catégories apparentées

Description générale

The gene MERTK (MER proto-oncogene, tyrosine kinase) is mapped to human chromosome 2q14.1. The encoded protein belongs to the Tyro3, Axl, and Mertk (TAM) family of receptor tyrosine kinases. MERTK is strongly expressed in macrophages, ovary, prostate, testis, lung and kidney. The protein has a conserved intracellular kinase domain and an extracellular adhesion molecule-like domain.

Immunogène

MERTK (NP_006334, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP

Actions biochimiques/physiologiques

MERTK (MER proto-oncogene, tyrosine kinase) is mainly involved in the starting of efferocytosis, which is the removal of dying cells by phagocytosis. It interacts with two ligands, Gas6 (growth arrest-specific 6) and Protein-S. Mutation in this gene regulates the severity of fibrosis in patients with non-alcoholic fatty liver disease. Mutations in MERTK gene also result in autosomal recessive retinal degeneration due to faults in phagocytosis. MERTK is upregulated in malignant cells, including leukemia, lymphoma and colorectal cancer. Variants of this gene are detected in melanoma, multiple myeloma, renal cancer and carcinoma. MERTK is also overexpressed in sclerotic lesions.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

A novel start codon mutation of the MERTK gene in a patient with retinitis pigmentosa.
Jinda W
Molecular Vision, 342-351 (2016)
Human iPSC derived disease model of MERTK-associated retinitis pigmentosa.
Lukovic D, et.al
Scientific Reports, 5, 12910-12910 (2015)
MERTK rs4374383 polymorphism affects the severity of fibrosis in non-alcoholic fatty liver disease.
Petta S
Journal of Hepatology, 64(3), 682-690 (2016)
Andreea Cristina Mihaila et al.
Cells, 13(3) (2024-02-09)
Following myocardial infarction (MI), blood neutrophils quickly and extensively infiltrate the heart, where they are temporally polarized into pro-inflammatory (N1) and anti-inflammatory (N2) subpopulations. Neutrophil transmigration is rapidly followed by the accrual of macrophages (MACs), which are believed to undergo
A Comprehensive Review of Mutations in the MERTK Proto-Oncogene.
Parinot C and Nandrot EF
Advances in Experimental Medicine and Biology, 854, 259-265 (2016)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique