Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

5100

Sigma-Aldrich

CD164 human

recombinant, expressed in E. coli, 0.5 mg protein/mL

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352200
Nomenclature NACRES :
NA.75

Source biologique

human

Produit recombinant

expressed in E. coli

Description

0.05 mg of recombinant human CD164 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.

Stérilité

Filtered sterilized solution

Pureté

≥90% (SDS-PAGE)

Forme

liquid

Conditionnement

pkg of 50 μg

Concentration

0.5 mg protein/mL

Numéro d'accès

NP_006007

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

human ... CD164(8763)

Application

L'enduction du puits d'une plaque (à 6 puits) avec cette protéine de matrice CD164 recombinante dans un milieu spécifique pour CSH à hauteur de 1-10 μg/puits permet de réaliser des études in vitro sur l'interaction CSH humaines/récepteur.

Cette procédure peut servir de lignes directrices pour déterminer les conditions d'enduction optimales pour votre système de culture.
1. Décongeler CD164 et diluer jusqu'à la concentration souhaitée à l'aide de milieu sans sérum ou de PBS. La solution finale doit être suffisamment diluée pour que le volume ajouté recouvre uniformément la surface (1-10 μg/puits, plaque à 6 puits).
Remarque : Appliquer 1 ml de PBS dans chaque puits d'une plaque à 6 puits.
2. Ajouter 1 à 10 μg de protéine dans chaque puits et incuber toute une nuit entre 2 et 10 °C.
3. Après incubation, aspirer la solution restante.
4. Les plaques sont prêtes à être utilisées. Elle peuvent aussi être conservées entre 2 et 8 °C, sous forme humide ou séchée à l'air libre, si la stérilité est maintenue.

Séquence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Notes préparatoires

Le domaine extracellulaire complet de l'ADNc correspondant à la protéine CD164 humaine (a.a. 24-162) a été construit avec une étiquette HIS/T7 en position N-terminale (29) et a été exprimé dans E. coli sous forme de corps d'inclusion. Le produit final a été replié à l'aide d'une technologie unique de "repliement de protéine issue de corps d'inclusion avec variation de température" et purifié par chromatographie sous forme de protéine soluble.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Benedikt Demmert et al.
Materials (Basel, Switzerland), 12(11) (2019-06-07)
Calcareous biominerals typically feature a hybrid nanogranular structure consisting of calcium carbonate nanograins coated with organic matrices. This nanogranular organisation has a beneficial effect on the functionality of these bioceramics. In this feasibility study, we successfully employed a flow-chemistry approach
Santosh Prasad Gupta et al.
Journal of physics. Condensed matter : an Institute of Physics journal, 32(19), 194004-194004 (2020-01-21)
We present studies on the structure of complexes of the cationic, bilayer-forming surfactant, didodecyldimethylammonium bromide (DDAB), and the anionic polyelectrolyte sodium polyacrylate (PAANa). In the presence of uncomplexed polyelectrolyte in the coexisting aqueous solution, these complexes are found to exhibit
Y Masuzawa et al.
Journal of biochemistry, 112(5), 609-615 (1992-11-01)
The peanut agglutinin (PNA)-binding site is protein-bound Gal beta 1-->3GalNAc, and is a tumor-associated carbohydrate marker expressed in many human carcinomas. PNA-binding glycoproteins isolated from KATO-III human gastric carcinoma cells were deglycosylated by trifluoromethanesulfonic acid, and rabbit antibodies against the
A C Zannettino et al.
Blood, 92(8), 2613-2628 (1998-10-09)
Mucin-like molecules represent an emerging family of cell surface glycoproteins expressed by cells of the hematopoietic system. We report the isolation of a cDNA clone that encodes a novel transmembrane isoform of the mucin-like glycoprotein MGC-24, expressed by both hematopoietic
Zhenghui Shen et al.
Polymers, 13(4) (2021-03-07)
Coated paper with a porous coating layer may have enhanced light-scattering ability and thus favorable optical properties. However, the increased porosity of such a coating layer is likely to decrease the strength of the coated paper, thereby adversely affecting the

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique