Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SRP0158

Sigma-Aldrich

Histone H3 (2-58) human

recombinant, expressed in E. coli, ≥70% (SDS-PAGE)

Sinónimos:

HIST1H3E, Histone H3.1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

500 μG
509,00 €

509,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Solicitar un pedido a granel

Seleccione un Tamaño

Cambiar Vistas
500 μG
509,00 €

About This Item

Código UNSPSC:
12352200
NACRES:
NA.32

509,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Solicitar un pedido a granel

origen biológico

human

recombinante

expressed in E. coli

Ensayo

≥70% (SDS-PAGE)

Formulario

aqueous solution

mol peso

32 kDa

envase

pkg of 500 μg

condiciones de almacenamiento

avoid repeated freeze/thaw cycles

concentración

>0.02 mg/mL

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−70°C

Información sobre el gen

human ... HIST1H3E(8353)

Descripción general

The mammalian chromatin is present in nucleosomes, made of histone octamers (H2A,H2B,H3,H4)2. Mammals contain three main classes of histone H3 variants: the replicative histones (H3.1 and H3.2), the replacement histone (H3.3) and the centromeric histone (Cenp-A).[1][2][3]
Human Histone 3 (GenBank Accession No. NM_003532), (amino acid 2-58) with N-terminal GST tag, MW = 32kDa, expressed in an Escherichia coli expression system.

Aplicación

Suitable substrate for histone methyltransferases

Acciones bioquímicas o fisiológicas

Histone proteins are basic building blocks of chromatin.[4] H3.1 (also referred to as HIST1H3E) is mainly expressed in the S phase and is termed as replication-dependent histone.[5] Selective methylation of H3.1 controls replication in heterochromatin area.[6]

Forma física

Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.

Nota de preparación

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Selective methylation of histone H3 variant H3.1 regulates heterochromatin replication.
Jacob Y, et al.
Science, 343, 1249-1249 (2014)
Genome-wide analysis of histone H3 lysine 4 trimethylation in peripheral blood mononuclear cells of minimal change nephrotic syndrome patients.
Zhang L, et al.
American Journal of Nephrology, 30, 505-505 (2009)
Topography of the histone octamer surface: repeating structural motifs utilized in the docking of nucleosomal DNA.
Arents G and Moudrianakis EN
Proceedings of the National Academy of Sciences of the USA, 90, 10489-10489 (1993)
Eric I Campos et al.
Nature structural & molecular biology, 17(11), 1343-1351 (2010-10-19)
The mechanism by which newly synthesized histones are imported into the nucleus and deposited onto replicating chromatin alongside segregating nucleosomal counterparts is poorly understood, yet this program is expected to bear on the putative epigenetic nature of histone post-translational modifications.
Signaling to chromatin through histone modifications.
P Cheung et al.
Cell, 103(2), 263-271 (2000-11-01)

Preguntas

1–2 de 2 Preguntas  
  1. What is the Department of Transportation shipping information for this product?

    1 respuesta
    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      ¿Le ha resultado útil?

  2. What is the amino acid sequence of Histone H3 (2-58) human, product SRP0158?

    1 respuesta
    1. The sequence for product SRP0158, Histone H3 (2-58) human, is as follows:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS

      ¿Le ha resultado útil?

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico