SAB2108151

Anti-HNF1B antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ADTKD3, Anti-FJHN, Anti-HNF-1-beta, Anti-HNF-1B, Anti-HNF1beta, Anti-HNF2, Anti-HPC11, Anti-LF-B3, Anti-LFB3, Anti-MODY5, Anti-RCAD, Anti-T2D, Anti-TCF-2, Anti-TCF2, Anti-VHNF1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 61kDa
• reactividad de especies: bovine, human, horse, pig
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunoblotting: suitable
• Nº de acceso NCBI: NM_000458
• Nº de acceso UniProt: P35680
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... HNF1B(6928)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human HNF1B

Acciones bioquímicas o fisiológicas

HNF1B is a member of the transcription factor superfamily. It forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined.This gene encodes a member of the transcription factor superfamily. The encoded protein forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-473 DC340648.1 1-473 474-1994 BC017714.1 441-1961 1995-2544 AC091199.6 29528-30077 2545-2842 AI797324.1 1-298 c

Secuencia

Synthetic peptide located within the following region: NFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable