MSST0040

SILu^™Lite IFNG Interferon Gamma human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Sinónimos: IFNγ, IFN-gamma, Immune interferon, Immuneinterferon
• NACRES: NA.12
• UNSPSC Code: 23201100
• Form: lyophilized powder
• Assay: ≥98% (SDS-PAGE)
• Biological source: human
• Recombinant: expressed in HEK 293 cells
• Mol wt: calculated mol wt 17 kDa

Propiedades

• biological source: human
• Quality Segment: 200
• recombinant: expressed in HEK 293 cells
• assay: ≥98% (SDS-PAGE)
• form: lyophilized powder
• potency: ≥98% Heavy amino acids incorporation efficiency by MS
• mol wt: calculated mol wt 17 kDa
• technique(s): mass spectrometry (MS): suitable, protein mass spectrometry: suitable
• suitability: suitable for mass spectrometry (internal calibrator)
• UniProt accession no.: P01579
• storage temp.: −20°C
• Gene Information: human ... IFNG(3458)

Descripción

General description

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

Immunogen

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Biochem/physiol Actions

SILu^™Lite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Physical form

Lyophilized from a solution of phosphate buffered saline.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Información de seguridad

• Clase de almacenamiento: 11 - Combustible Solids
• ¿Qué está pasando?: WGK 2
• Punto de inflamación (°F): Not applicable
• Punto de inflamación (°C): Not applicable