AV31874

Anti-ZBTB32 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Zinc finger and BTB domain containing 32
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 33 kDa
• reactividad de especies: rat, human, bovine, guinea pig, rabbit
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_055198
• Nº de acceso UniProt: Q8WVP2
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ZBTB32(27033)

Descripción

Descripción general

ZBTB32 is a zinc-finger protein that can repress the expression of CIITA and MHC II genes during B cell differentiation.
Rabbit Anti-ZBTB32 recognizes bovine, mouse, canine, and human ZBTB32.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ZBTB32

Aplicación

Rabbit Anti-ZBTB32 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Acciones bioquímicas o fisiológicas

ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.

Secuencia

Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable