Synthetic peptide directed towards the middle region of human CXCL3
Aplicación
Anti-CXCL3 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Acciones bioquímicas o fisiológicas
CXCL3 is a chemokine that binds to CXCR1 and CXCR2 receptors and stimulates p38 and ERK1/2-dependent migration of asthmatic airway smooth muscle cells. Prostate stromal cells secrete CXCL3 in response to IL-1 that results in prostatic inflammation in early stages of prostate cancer formation.
Descripción de destino
CXCL3 is a chemokine that affects migration and adhesion of monocytes. CXCR2 is its known receptor.
Secuencia
Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Journal of immunology (Baltimore, Md. : 1950), 191(5), 2731-2741 (2013-08-02)
Structural cell migration plays a central role in the pathophysiology of several diseases, including asthma. Previously, we established that IL-17-induced (CXCL1, CXCL2, and CXCL3) production promoted airway smooth muscle cell (ASMC) migration, and consequently we sought to investigate the molecular
Frontiers in neuroscience, 12, 1016-1016 (2019-01-29)
Fibroblasts (Fbs) effectively promote Schwann cells (SCs) migration, proliferation, and neurite regeneration. Whether Fbs express different motor and sensory phenotypes that regulate the cell behavior and peripheral nerve function has not been elucidated. The present study utilized the whole rat
It is well accepted that tumor microenvironment is essential for tumor cells survival, cancer progression and metastasis. However, the mechanisms by which tumor cells interact with their surrounding at early stages of cancer development are largely unidentified. The aim of
Preguntas
Revisiones
★★★★★ Sin puntuación
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
