Direkt zum Inhalt
Merck

WH0054455M2

Sigma-Aldrich

Monoclonal Anti-FBXO42 antibody produced in mouse

clone 2F10, purified immunoglobulin, buffered aqueous solution

Synonym(e):

Anti-F-box protein 42, Anti-Fbx42, Anti-KIAA1332

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μG
490,00 €

490,00 €


Voraussichtliches Versanddatum30. Mai 2025



Größe auswählen

Ansicht ändern
100 μG
490,00 €

About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

490,00 €


Voraussichtliches Versanddatum30. Mai 2025


Biologische Quelle

mouse

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

2F10, monoclonal

Form

buffered aqueous solution

Speziesreaktivität

human, mouse, rat

Methode(n)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2aκ

GenBank-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... FBXO42(54455)

Verwandte Kategorien

Allgemeine Beschreibung

Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM

Immunogen

FBXO42 (NP_061867, 619 a.a. ~ 717 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR

Biochem./physiol. Wirkung

FBXO42 (F-box protein 42) works in the ubiquitin-proteasome system and is involved in protein degradation. It mainly participates in the assembly of the SCF (skp, cullin, F-box containing) complex. FBXO42 is responsible for the ubiquitination and subsequent degradation of p53. It is also involved in the ubiquitination and degradation of ING4 (inhibitor of growth family member 4), thereby enhancing angiogenesis and metastasis of breast cancer. FBXO42 might be associated with Parkinson′s disease (PD).

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

nwg

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Kai Gao et al.
BMC neurology, 13, 125-125 (2013-09-26)
Parkinson's disease (PD), the second most common neurodegenerative disease, is characterized by loss of dopaminergic neurons in the substantia nigra. The clinical manifestations of PD encompass a variety of motor and non-motor symptoms. Mutations in the F-box protein 7 gene
Ruorong Yan et al.
Genes & development, 29(6), 672-685 (2015-03-21)
Loss of function/dysregulation of inhibitor of growth 4 (ING4) and hyperactivation of NF-κB are frequent events in many types of human malignancies. However, the molecular mechanisms underlying these remarkable aberrations are not understood. Here, we report that ING4 is physically
Luyang Sun et al.
Proceedings of the National Academy of Sciences of the United States of America, 106(25), 10195-10200 (2009-06-11)
The p53 tumor suppressor plays a central role in integrating cellular responses to various stresses. Tight regulation of p53 is thus essential for the maintenance of genome integrity and normal cell proliferation. Currently, several ubiquitin ligases, including the single-subunit RING-finger
Luyang Sun et al.
The Journal of biological chemistry, 286(6), 4226-4235 (2010-12-04)
The p53 tumor suppressor plays a central role in integrating cellular responses to various stresses. Tight regulation of p53 is thus essential for the maintenance of genome integrity and normal cell proliferation. Previously, we reported that JFK, the only Kelch

Fragen

Bewertungen

Kein Beurteilungswert

Aktive Filter

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.