SAB2101084

Anti-HSD11B1 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-11-β-HSD1, Anti-11-DH, Anti-HDL, Anti-HSD11, Anti-Hydroxysteroid (11-β) dehydrogenase 1
• MDL-Nummer: MFCD08064405
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 32 kDa
• Speziesreaktivität: human, mouse, rat, guinea pig
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• UniProt-Hinterlegungsnummer: P28845
• Anwendung(en): research pathology
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... HSD11B1(3290)

Beschreibung

Allgemeine Beschreibung

Hydroxysteroid 11-beta dehydrogenase 1 (HSD11B1) short-chain dehydrogenase/reductase superfamily and anchors on the endoplasmic reticulum (ER) membrane. It comprises a hydrophobic N terminus and a catalytic domain. The HSD11B1 gene is mapped to human chromosome location 1q32.2.

Immunogen

Synthetic peptide directed towards the N terminal region of human HSD11B1

Biochem./physiol. Wirkung

Mutation in the hydroxysteroid 11-β dehydrogenase 1 (HSD11B1) gene is implicated in cortisone reductase deficiency.

Sequenz

Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable