Direkt zum Inhalt
Merck

SAB1412328

Sigma-Aldrich

ANTI-ATF3 antibody produced in mouse

clone 8D8, purified immunoglobulin, buffered aqueous solution

Synonym(e):

ATF3

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μG
492,00 €

492,00 €


Check Cart for Availability


Größe auswählen

Ansicht ändern
100 μG
492,00 €

About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

492,00 €


Check Cart for Availability

Biologische Quelle

mouse

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

8D8, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen 45.65 kDa

Speziesreaktivität

human

Methode(n)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG1κ

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... ATF3(467)

Allgemeine Beschreibung

Activating transcription factor 3 (ATF3) is encoded by the gene mapped to human chromosome 1q. It belongs to the ATF/cAMP response element binding (CREB) family of transcription factors. The encoded protein contains a basic region involved in specific DNA binding, and a leucine zipper (bZIP) motif responsible for forming homodimers or heterodimers with other bZIP-containing proteins. ATF3 protein is expressed at low levels in normal and quiescent cells, but its expression is triggered on exposure to extracellular signals such as, growth factors, cytokines and some genotoxic stress agents.
Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes. (provided by RefSeq)

Immunogen

ATF3 (AAH06322, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Biochem./physiol. Wirkung

Activating transcription factor 3 (ATF3) plays a vital role as a novel neuronal marker of nerve injury in the nervous system. ATF3 negatively regulates toll-like receptors (TLR)-stimulated inflammatory response. The encoded protein possibly plays an essential role in homeostasis, wound healing, cell adhesion, cancer cell invasion, apoptosis and signaling pathways. Over-expression of this protein stops cell cycle progression. Increased expression of ATF3 on exposure to stress signals or DNA damage, is regulated by various signaling pathway including, p53-dependent and -independent pathways, and may also involve mitogen-activated protein (MAP) kinase signaling pathways.
ATF3 plays bifurcated roles in cancer development by stimulating apoptosis in the untransformed MCF10A (a breast cancer progression cell line) mammary epithelial cells and also conserve aggressive MCF10CA1a cells and promotes its cell motility.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Feiyue Fan et al.
Oncogene, 21(49), 7488-7496 (2002-10-19)
Mammalian cells have a remarkable diverse repertoire of response to genotoxic stress that damage DNA. Cellular responses to DNA damaging agents will initially exhibit gene induction, which is regulated by complex mechanism(s) and probably involves multiple signaling pathways. In this
T Hai et al.
Gene expression, 7(4-6), 321-335 (1999-08-10)
The purpose of this review is to discuss ATF3, a member of the ATF/CREB family of transcription factors, and its roles in stress responses. In the introduction, we briefly describe the ATF/CREB family, which contains more than 10 proteins with
X Yin et al.
Oncogene, 27(15), 2118-2127 (2007-10-24)
Activating transcription factor 3 (ATF3) is a member of the ATF/cyclic AMP response element-binding family of transcription factors. We present evidence that ATF3 has a dichotomous role in cancer development. By both gain- and loss-of-function approaches, we found that ATF3
H Tsujino et al.
Molecular and cellular neurosciences, 15(2), 170-182 (2000-02-16)
Activating transcription factor 3 (ATF3), a member of ATF/CREB family of transcription factors, is induced in a variety of stressed tissue. ATF3 regulates transcription by binding to DNA sites as a homodimer or heterodimer with Jun proteins. The purpose of
Matthew R Thompson et al.
Journal of molecular medicine (Berlin, Germany), 87(11), 1053-1060 (2009-08-26)
Activating transcription factor 3 (ATF3) is a member of the ATF/cyclic AMP response element-binding (ATF/CREB) family of transcription factors. It is an adaptive-response gene that participates in cellular processes to adapt to extra- and/or intracellular changes, where it transduces signals

Fragen

Bewertungen

Kein Beurteilungswert

Aktive Filter

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.