Direkt zum Inhalt
Merck

SAB1411910

Sigma-Aldrich

ANTI-PPARGC1A antibody produced in mouse

clone 3B5, purified immunoglobulin, buffered aqueous solution

Synonym(e):

LEM6, PGC-1(alpha), PGC-1v, PGC1, PPARGC1A

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μG
418,00 €

418,00 €


Versandbereit am28. April 2025Details



Größe auswählen

Ansicht ändern
100 μG
418,00 €

About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

418,00 €


Versandbereit am28. April 2025Details


Biologische Quelle

mouse

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

3B5, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen 37.84 kDa

Speziesreaktivität

human

Methode(n)

indirect ELISA: suitable
indirect immunofluorescence: suitable

Isotyp

IgG2aκ

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

Allgemeine Beschreibung

PPARG (peroxisome proliferator activated receptor gamma) coactivator 1 α (PPARGC1A) is a 91kDa multifunctional regulatory factor, encoded by the gene mapped to human chromosome 4p15.1. The encoded protein is mainly expressed in heart, skeletal muscle and kidney.
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. (provided by RefSeq)

Immunogen

PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Biochem./physiol. Wirkung

PPARG coactivator 1 α (PPARGC1A) interacts with a wide range of transcription factors and plays a vital role in cellular energy metabolism. The encoded protein regulates activity of many transcription factors and functions as a molecular switch for various cellular processes, such as mitochondrial biogenesis and respiration, gluconeogenesis and glucose transport, glycogenolysis, fatty acid oxidation, peroxisomal remodeling, muscle fiber-type switching and oxidative phosphorylation. Additionally, it is also acts as a regulator of Type 2 diabetes mellitus (T2DM) and is considered to be a potential target for anti-diabetic therapy. The protein functions as a tumor suppressor in hepatocellular carcinoma and can be used as a promising therapeutic target for the same. It is downregulated in prostate cancer. Presence of PPARGC1A inhibits prostate cancer progression and metastasis. However, presence of this protein gives selective advantages in breast cancer and melanoma cells.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Chi Luo et al.
Nature, 537(7620), 422-426 (2016-09-01)
Melanoma is the deadliest form of commonly encountered skin cancer because of its rapid progression towards metastasis. Although metabolic reprogramming is tightly associated with tumour progression, the effect of metabolic regulatory circuits on metastatic processes is poorly understood. PGC1α is
Haijiang Wu et al.
The Journal of endocrinology, 229(3), R99-R115 (2016-04-21)
Type 2 diabetes mellitus (T2DM) is a chronic disease characterized by glucose metabolic disturbance. A number of transcription factors and coactivators are involved in this process. Peroxisome proliferator-activated receptor gamma coactivator 1 alpha (PGC-1α) is an important transcription coactivator regulating
Rui Liu et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 39(4), 1010428317695031-1010428317695031 (2017-04-07)
Peroxisome proliferator-activated receptor gamma coactivator-1 alpha plays a crucial role in regulating the biosynthesis of mitochondria, which is closely linked to the energy metabolism in various tumors. This study investigated the regulatory role of peroxisome proliferator-activated receptor gamma coactivator-1 alpha
Veronica Torrano et al.
Nature cell biology, 18(6), 645-656 (2016-05-24)
Cellular transformation and cancer progression is accompanied by changes in the metabolic landscape. Master co-regulators of metabolism orchestrate the modulation of multiple metabolic pathways through transcriptional programs, and hence constitute a probabilistically parsimonious mechanism for general metabolic rewiring. Here we

Fragen

Bewertungen

Kein Beurteilungswert

Aktive Filter

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.