Direkt zum Inhalt
Merck

HPA015315

Sigma-Aldrich

Anti-WHSC1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-Multiple myeloma SET domain-containing protein, Anti-Nuclear SET domain-containing protein 2, Anti-Probable histone-lysine N-methyltransferase NSD2, Anti-Protein trithorax-5, Anti-Wolf-Hirschhorn syndrome candidate 1 protein

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:

Biologische Quelle

rabbit

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Methode(n)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect immunofluorescence: suitable
western blot: suitable

Immunogene Sequenz

QAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVAKEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSA

Versandbedingung

wet ice

Lagertemp.

−20°C

Angaben zum Gen

human ... WHSC1(7468)

Allgemeine Beschreibung

WHSC1 (Wolf-Hirschhorn syndrome candidate 1) is an oncogene belonging to the SET domain containing NSD (nuclear receptor binding SET domain) protein family. It produces several different isoforms, with the predominant being MMSETII (Multiple Myeloma SET Domain), which resides in the nucleus. Another common isoform is called REIIBP (interleukin-5 [IL-5] response element II binding protein), which is localized to cytoplasm and nucleus both. This gene also codes for highly expressed ACA11, which is a small nucleolar RNA (snoRNA). This gene is composed of 24 exons, spans 120kb, and codes for 1365 amino acid MMSETII.[1]

Immunogen

Probable histone-lysine N-methyltransferase NSD2 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

WHSC1 (Wolf-Hirschhorn syndrome candidate 1) is involved in the regulation of apoptosis, cell cycle and cell adhesion. It is involved in the dimethylation of H3K36, and MMSETII is involved in the histone methylation of H3K4, H3K27, H3K36 and H4K20. This functionality of this protein is mediated through its SET domain. Chromosomal translocation t(4;14) of this gene is implicated in multiple myeloma (MM), and correlates with poor prognosis. In gastric cancer, the mRNA levels of WHSC1 are related to the response to first-line FOLFOX (Folinic acid, Fluorouracil (5-FU), Oxaliplatin) and second-line docetaxel therapy. Therefore, this gene can be used to determine chemotherapy in gastric cancer cases.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73692.

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

12 - Non Combustible Liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Zhigang Xie et al.
Oncotarget, 4(7), 1008-1018 (2013-08-01)
Multiple myeloma (MM) is characterized by recurrent chromosomal translocations. MMSET, identified by its fusion to the IgH locus in t(4;14) MM, is universally overexpressed in t(4;14) MM. In order to identify cell surface biomarkers associated with t(4;14) MM for small
J Wei et al.
British journal of cancer, 110(11), 2662-2668 (2014-05-09)
Breast cancer susceptibility gene 1 (BRCA1) expression differentially affects outcome to platinum- and taxane-based chemotherapy. Mediator of DNA damage checkpoint protein 1 (MDC1), p53-binding protein 1 (53BP1), multiple myeloma SET domain (MMSET) and ubiquitin-conjugating enzyme 9 (UBC9) are involved in
Fabio Mirabella et al.
PloS one, 9(6), e99493-e99493 (2014-06-14)
The chromosomal translocation t(4;14) deregulates MMSET (WHSC1/NSD2) expression and is a poor prognostic factor in multiple myeloma (MM). MMSET encodes two major protein isoforms. We have characterized the role of the shorter isoform (REIIBP) in myeloma cells and identified a

Fragen

Bewertungen

Kein Beurteilungswert

Aktive Filter

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.