HPA007547

Anti-ULBP1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-ALCAN-β antibody produced in rabbit, Anti-N2DL-1 antibody produced in rabbit, Anti-NKG2D ligand 1 precursor antibody produced in rabbit, Anti-NKG2DL1 antibody produced in rabbit, Anti-Retinoic acid early transcript 1I antibody produced in rabbit, Anti-UL16-binding protein 1 antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA007547

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunohistochemistry: 1:50- 1:200
• Immunogene Sequenz: THCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMS
• UniProt-Hinterlegungsnummer: Q9BZM6
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ULBP1(80329)

Beschreibung

Allgemeine Beschreibung

ULBP1 (Unique Long 16 binding protein 1) gene encodes a ligand for KLRK1/NKG2D (natural killer cell lec-tin-like receptor gene 2D) receptor. It consists of α1 and α2 domains, which are connected to the cell surface through glycosylphosphatidylinositol.This receptor is expressed on natural killer (NK) cells, NKT cells, γδ⁺ T cells and CD₈⁺ T cells.

Immunogen

NKG2D ligand 1 precursor recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-ULBP1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

ULBP1 (Unique Long 16 binding protein 1) functions as a stimulatory immune receptor and is expressed on natural killer (NK) cells, NKT cells, γδ+ T cells and CD⁸⁺ T cells. The expression of this ligand is stimulated upon infection and other inducers of cellular stress. This ligand binds to the receptor and initiates an immune response by activating multiple signaling pathways in primary NK cells. It serves as a prognostic marker in cervical cancer.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST71802

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)