Direkt zum Inhalt
Merck

HPA004899

Sigma-Aldrich

Anti-BCL6 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-B-cell lymphoma 6 protein antibody produced in rabbit, Anti-BCL-5 antibody produced in rabbit, Anti-BCL-6 antibody produced in rabbit, Anti-LAZ-3 protein antibody produced in rabbit, Anti-Zinc finger and BTB domain-containing protein 27 antibody produced in rabbit, Anti-Zinc finger protein 51 antibody produced in rabbit

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μL
480,00 €

480,00 €


Check Cart for Availability


Größe auswählen

Ansicht ändern
100 μL
480,00 €

About This Item

MDL-Nummer:
UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

480,00 €


Check Cart for Availability

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Verfügbarkeit

not available in USA

Erweiterte Validierung

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Immunogene Sequenz

NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... BCL6(604)

Verwandte Kategorien

Allgemeine Beschreibung

BCL6 (B-cell CLL/lymphoma 6) is a nuclear protein, belonging to the BTB/POZ (BR-C, ttk and bab/Pox virus and Zinc finger) domain family of transcription factors. This zinc finger transcription factor has a molecular mass of 95kDa.

Immunogen

B-cell lymphoma 6 protein recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-BCL6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem./physiol. Wirkung

BCL6 (B-cell CLL/lymphoma 6) is mainly involved in the regulation of B lymphocyte development and growth. Bcl6 acts as a diagnostic marker to identify the level of severity of various diseases. It is predominantly expressed in human cancers such as lymphoid malignancy, breast cancer. In breast cancer, it is associated with the proliferation, anchorage-independent growth, migration, and invasion. It is involved in the BCL6 translocation of primary central nervous system lymphoma, which is further linked with apoptosis process. It is a prime gene in B-cell lymphomagenesis. It has been reported that BCL6 may have corealtion with the preeclampsia.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST86935

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Stefanie Schlager et al.
Oncotarget, 11(9), 875-890 (2020-03-18)
Diffuse large B-cell lymphoma (DLBCL) is the most common type of non-Hodgkin lymphomas worldwide and is characterized by a high diversity of genetic and molecular alterations. Chromosomal translocations and mutations leading to deregulated expression of the transcriptional repressor BCL6 occur
B-cell lymphoma 6 protein stimulates oncogenicity of human breast cancer cells.
Wu Q, Liu X, Yan H, et al.
BMC Cancer, 14, 418-418 (2014)
Nina Kerres et al.
Cell reports, 20(12), 2860-2875 (2017-09-21)
The transcription factor BCL6 is a known driver of oncogenesis in lymphoid malignancies, including diffuse large B cell lymphoma (DLBCL). Disruption of its interaction with transcriptional repressors interferes with the oncogenic effects of BCL6. We used a structure-based drug design to
Targeted gene analysis: increased B-cell lymphoma 6 in preeclamptic placentas.
Louwen F, Muschol-Steinmetz C, Friemel A, et al.
Human Pathology, 45(6), 1234-1242 (2014)
Tatjana Crnogorac-Jurcevic et al.
PloS one, 8(1), e54830-e54830 (2013-02-02)
With less than a 5% survival rate pancreatic adenocarcinoma (PDAC) is almost uniformly lethal. In order to make a significant impact on survival of patients with this malignancy, it is necessary to diagnose the disease early, when curative surgery is

Fragen

Bewertungen

Kein Beurteilungswert

Aktive Filter

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.