219482

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable

Caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58).

• Synonym(s): Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
• Empirical Formula (Hill Notation): C₂₂₈H₃₃₅N₆₁O₄₉S
• Molecular Weight: 4746.54
• NACRES: NA.77
• UNSPSC Code: 12352202
• Assay: ≥95% (HPLC)
• Form: lyophilized solid
• Storage condition: OK to freeze, desiccated (hygroscopic), protect from light

Properties

• Quality Segment: 100
• assay: ≥95% (HPLC)
• form: lyophilized solid
• manufacturer/tradename: Calbiochem^®
• storage condition: OK to freeze, desiccated (hygroscopic), protect from light
• color: white
• solubility: DMSO: 2 mg/mL
• shipped in: wet ice
• storage temp.: −20°C

Description

General description

Caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD_82-101 sequence.

Biochem/physiol Actions

Cell permeable: yes

Primary Target
eNOS

Product does not compete with ATP.

Reversible: no

Packaging

Packaged under inert gas

Physical form

Supplied as a trifluoroacetate salt.

Preparation Note

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Other Notes

Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA102, 761.
Williams, T.M., et al. 2004. J. Biol. Chem.279, 51630.
Gratton, J.P., et al. 2003. Cancer Cell4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem.277, 50716.
Liu, J., et al. 2002. J. Biol. Chem.277, 10661.
Bucci, M., et al. 2000. Nat. Med.6, 1362.
Okamoto, T., et al. 1998. J. Biol. Chem.273, 5419.

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Toxicity: Carcinogenic / Teratogenic (D)

Safety Information

• Storage Class: 11 - Combustible Solids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable