WH0010014M1

Monoclonal Anti-HDAC5 antibody produced in mouse

clone 4G2, purified immunoglobulin, buffered aqueous solution

• Synonyma: Anti-HD5, Anti-NYCO9, Anti-histone deacetylase 5
• MDL number: MFCD04040361
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4G2, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: BC051824
• UniProt accession no.: Q9UQL6
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HDAC5(10014)

Popis

Immunogen

HDAC5 (AAH51824, 330 a.a. ~ 429 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLG

Biochem/physiol Actions

Histone deacetylase 5 (HDAC5) promotes progression of the cell cycle, cell proliferation and apoptosis. Reduced expression of the protein is observed in colon cancer and acute myeloid leukemia.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)