WH0007291M1

Monoclonal Anti-TWIST1 antibody produced in mouse

clone 3E11, purified immunoglobulin, buffered aqueous solution

• Synonyma: Anti-ACS3, Anti-BPES2, Anti-BPES3, Anti-SCS, Anti-TWIST, Anti-twist homolog 1 (acrocephalosyndactyly 3; Saethre-Chotzen syndrome) (Drosophila)
• MDL number: MFCD08705531
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3E11, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_000474
• UniProt accession no.: Q15672
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TWIST1(7291)

Popis

General description

Twist family bHLH transcription factor 1 (TWIST1) is a basic helix-loop-helix transcription factor and the gene encoding it is localized on human chromosome 7p21.1.

Immunogen

TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Biochem/physiol Actions

Twist family bHLH transcription factor 1 (TWIST1) has a role in the determination of cell lineage and differentiation during embryogenesis. During the development of neural crest, it is also involved in modulating cell movement and tissue reorganization. Mutations in the TWIST1 gene have been associated with Saethre-Chotzen syndrome (4) and the protein is also linked to various cancers.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)