Přejít k obsahu
Merck
Všechny fotografie(4)

Key Documents

WH0000142M1

Sigma-Aldrich

Monoclonal Anti-PARP1 antibody produced in mouse

clone 3G4, purified immunoglobulin, buffered aqueous solution

Synonyma:

PARP1 Antibody - Monoclonal Anti-PARP1 antibody produced in mouse, Parp1 Antibody, Anti-ADPRT, Anti-ADPRT1, Anti-PARP, Anti-PARP1, Anti-PPOL, Anti-pADPRT1, Anti-poly (ADP-ribose) polymerase family, member 1

Přihlásitk zobrazení cen stanovených pro organizaci a smluvních cen
Všechny fotografie(4)

About This Item

MDL number:
MFCD01322527
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3G4, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

BC037545

UniProt accession no.

P09874

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PARP1(142)

Související kategorie

General description

Poly (ADP-ribose) polymerase 1 (PARP1) is a nuclear protein and belongs to the PARP family. This protein is made up of the N-terminal DNA-binding domain, central auto modification domain and C-terminal catalytic domain. PARP1 protein is located on the nucleoli. The PARP1 gene is located on the human chromosome at 1q42.12.

Immunogen

PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD

Application

Monoclonal Anti-PARP1 antibody produced in mouse has been used in:
  • western blotting
  • indirect immunofluorescence
  • high-throughput cellular thermal shift assay (CESTA HT)

Biochem/physiol Actions

Poly (ADP-ribose) polymerase 1 (PARP1) protein plays a role in DNA repair by catalyzing the polymerization of adenosine diphosphate (ADP)-ribose units. This protein also plays a role in the early response to DNA damage. Mutations in the PARP1 gene is associated with loss of cell viability.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ještě jste nenalezli správný produkt?  

Vyzkoušejte náš produkt Nástroj pro výběr produktů.

recommended

Č. produktu
Popis
Stanovení ceny

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Osvědčení o analýze (COA)

Vyhledejte osvědčení Osvědčení o analýze (COA) zadáním čísla šarže/dávky těchto produktů. Čísla šarže a dávky lze nalézt na štítku produktu za slovy „Lot“ nebo „Batch“.

Již tento produkt vlastníte?

Dokumenty související s produkty, které jste v minulosti zakoupili, byly za účelem usnadnění shromážděny ve vaší Knihovně dokumentů.

Navštívit knihovnu dokumentů

Yingbiao Ji et al.
Current opinion in genetics & development, 20(5), 512-518 (2010-07-02)
Cell growth and differentiation during developmental processes require the activation of many inducible genes. However, eukaryotic chromatin, which consists of DNA and histones, becomes a natural barrier impeding access to the functional transcription machinery. To break through the chromatin barrier
Michèle Rouleau et al.
Nature reviews. Cancer, 10(4), 293-301 (2010-03-05)
Recent findings have thrust poly(ADP-ribose) polymerases (PARPs) into the limelight as potential chemotherapeutic targets. To provide a framework for understanding these recent observations, we review what is known about the structures and functions of the family of PARP enzymes, and
Arnab Ray Chaudhuri et al.
Nature reviews. Molecular cell biology, 18(10), 610-621 (2017-07-06)
Cells are exposed to various endogenous and exogenous insults that induce DNA damage, which, if unrepaired, impairs genome integrity and leads to the development of various diseases, including cancer. Recent evidence has implicated poly(ADP-ribose) polymerase 1 (PARP1) in various DNA
Esin Orhan et al.
Cancer letters, 589, 216820-216820 (2024-04-05)
One in three Triple Negative Breast Cancer (TNBC) is Homologous Recombination Deficient (HRD) and susceptible to respond to PARP inhibitor (PARPi), however, resistance resulting from functional HR restoration is frequent. Thus, pharmacologic approaches that induce HRD are of interest. We
Y Liu et al.
Cancer gene therapy, 24(5), 208-214 (2017-03-11)
Cisplatin resistance hinders the efficacy of chemotherapy in ovarian cancer. MicroRNAs (miRs) have been implicated in drug resistance in anti-cancer chemotherapy. We compared the expression profiles of miRs between cisplatin-resistant and cisplatin-sensitive ovarian cancer cells, and found that miR-216b was
Zobrazit všechny související dokumenty

Náš tým vědeckých pracovníků má zkušenosti ve všech oblastech výzkumu, včetně přírodních věd, materiálových věd, chemické syntézy, chromatografie, analytiky a mnoha dalších..

Obraťte se na technický servis.