SAB5201356

Monoclonal Anti-Ataxin 1 antibody produced in mouse

clone S76-8, purified immunoglobulin

• Synonyma: Anti-ATX1, Anti-D6S504E, Anti-Spinocerebellar ataxia type 1 protein
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: S76-8, monoclonal
• form: buffered aqueous solution
• mol wt: antigen predicted mol wt 85 kDa
• species reactivity: human, mouse, rat
• concentration: 1 mg/mL
• technique(s): immunohistochemistry: suitable; immunoprecipitation (IP): suitable; western blot: suitable
• isotype: IgG2b
• NCBI accession no.: NP_001186233.1
• UniProt accession no.: P54253
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: mouse ... Atxn1(20238)

Popis

Immunogen

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

PBS pH 7.4, 50% glycerol, 0.1% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable