SAB2108392

Anti-S100B antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 10kDa
• species reactivity: goat, rabbit, bovine, rat, mouse, guinea pig, human, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunoblotting: suitable
• NCBI accession no.: NM_013191
• UniProt accession no.: P04631
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... S100B(6285) ; rat ... S100b(25742)

Popis

Immunogen

The immunogen for anti-S100B antibody: synthetic peptide directed towards the N terminal of human S100B

Biochem/physiol Actions

S100b binds GTPase activating protein IQGAP1; It may play a role in cell membrane rearrangement.

Sequence

Synthetic peptide located within the following region: KLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable