SAB2104741

Anti-MRPL37, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonyma: Anti-MGC878, Anti-MRPL2, Anti-RPML2
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 48 kDa
• species reactivity: rat, horse, bovine, human, rabbit, mouse, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_016491
• UniProt accession no.: Q9BZE1
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... MRPL37(51253)

Popis

General description

The gene MRPL37 (mitochondrial ribosomal protein L37) is mapped to human chromosome 1p32.3. The gene encodes a mitochondrial ribosomal protein of the large subunit. The MRPL37 protein associates with MTO1 (mitochondrial translation optimization factor 1), a regulator of mitochondrial translation.

Immunogen

Synthetic peptide directed towards the N terminal region of human MRPL37

Sequence

Synthetic peptide located within the following region: VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable