SAB1404273

Monoclonal Anti-PTGIR, (C-terminal) antibody produced in mouse

clone 2A7, purified immunoglobulin, buffered aqueous solution

• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2A7, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~36.12 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: NM_000960
• UniProt accession no.: P43119
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PTGIR(5739)

Popis

General description

The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor. (provided by RefSeq)

Immunogen

PTGIR (NP_000951, 296 a.a. ~ 386 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC

Physical form

Solution in phosphate buffered saline, pH 7.4

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable