SAB1404139

Monoclonal Anti-NOTCH3 antibody produced in mouse

clone 2E2, purified immunoglobulin, buffered aqueous solution

• Synonyma: CADASIL, CASIL
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2E2, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~38.21 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: NM_000435
• UniProt accession no.: Q9UM47
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NOTCH3(4854)

Popis

General description

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL). (provided by RefSeq)

Immunogen

NOTCH3 (NP_000426, 47 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable