SAB1402845

Monoclonal Anti-CXCL9, (C-terminal) antibody produced in mouse

clone 1F5, purified immunoglobulin, buffered aqueous solution

• Synonyma: CMK, Humig, MIG, SCYB9, crg-10
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1F5, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.44 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: BC063122
• UniProt accession no.: Q07325
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CXCL9(4283)

Popis

General description

The function of this gene has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines. (provided by RefSeq)

Immunogen

CXCL9 (AAH63122, 23 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Physical form

Solution in phosphate buffered saline, pH 7.4

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable