Přejít k obsahu
Merck
Všechny fotografie(6)

Key Documents

HPA037606

Sigma-Aldrich

Anti-CEP164 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyma:

Anti-KIAA1052, Anti-NPHP15

Přihlásitk zobrazení cen stanovených pro organizaci a smluvních cen


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CEP164(22897)

General description

Centrosomal protein 164 (CEP164) is a centriole appendage protein encoded by the gene mapped to human chromosome 11q23.3. CEP164 is apparently a 164kDa protein composed of 1,460 amino acids and is specifically localized on mature centrioles. The encoded protein mainly contains a putative N-terminal WW domain and three coiled-coil domains.

Immunogen

centrosomal protein 164kDa recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

Centrosomal protein 164 (CEP164) plays an essential role in primary cilium formation. In addition, it also acts as a potential marker for distal appendages on mature centrioles or basal bodies. Mutation in the gene is associated with early defects in ciliogenesis. CEP164 directs tau tubulin kinase 2 (TTBK2) to the mother centriole and thus stimulates ciliogenesis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST80528

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ještě jste nenalezli správný produkt?  

Vyzkoušejte náš produkt Nástroj pro výběr produktů.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Osvědčení o analýze (COA)

Vyhledejte osvědčení Osvědčení o analýze (COA) zadáním čísla šarže/dávky těchto produktů. Čísla šarže a dávky lze nalézt na štítku produktu za slovy „Lot“ nebo „Batch“.

Již tento produkt vlastníte?

Dokumenty související s produkty, které jste v minulosti zakoupili, byly za účelem usnadnění shromážděny ve vaší Knihovně dokumentů.

Navštívit knihovnu dokumentů

MLL partner genes in secondary acute lymphoblastic leukemia: report of a new partner PRRC1 and review of the literature.
Douet-Guilbert N
Leukemia Research, 38, 1316-1319 (2014)
Ebtissal M Khouj et al.
Journal of cell science, 132(19) (2019-09-08)
Centrin 2 is a small conserved calcium-binding protein that localizes to the centriolar distal lumen in human cells. It is required for efficient primary ciliogenesis and nucleotide excision repair (NER). Centrin 2 forms part of the xeroderma pigmentosum group C
CEP164-null cells generated by genome editing show a ciliation defect with intact DNA repair capacity.
Journal of Cell Science, 129, 1769-1774 (2016)
Cep164, a novel centriole appendage protein required for primary cilium formation.
Graser S, et.al.
The Journal of Cell Biology, 179, 321-330 (2007)
Caroline Alby et al.
American journal of human genetics, 97(2), 311-318 (2015-07-15)
KIAA0586, the human ortholog of chicken TALPID3, is a centrosomal protein that is essential for primary ciliogenesis. Its disruption in animal models causes defects attributed to abnormal hedgehog signaling; these defects include polydactyly and abnormal dorsoventral patterning of the neural

Náš tým vědeckých pracovníků má zkušenosti ve všech oblastech výzkumu, včetně přírodních věd, materiálových věd, chemické syntézy, chromatografie, analytiky a mnoha dalších..

Obraťte se na technický servis.