Přejít k obsahu
Merck
Všechny fotografie(4)

Hlavní dokumenty

AV38284

Sigma-Aldrich

Anti-TFAP2C antibody produced in rabbit

IgG fraction of antiserum

Synonyma:

Anti-AP2γ, Anti-ERF1, Anti-TFAP2G, Anti-Transcription factor AP-2 γ (activating enhancer binding protein 2 γ), Anti-hAP-2g

Přihlásitk zobrazení cen stanovených pro organizaci a smluvních cen


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

49 kDa

species reactivity

dog, mouse, human, pig, bovine, rabbit, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TFAP2C(7022)

General description

The AP2 family of transcription factors is expressed during mammalian development, morphogenesis and in various malignancies. Transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma) (TFAP2G, AP2gamma, ERF1, TFAP2G, AP2-gamma) is a retinoic acid-responsive gene involved in placental development and the progression of human breast cancer. AP2-gamma is required for development and maintenance of extra-embryonic membranes, trophectoderm.

Specificity

Anti-TFAP2C polyclonal antibody reacts with human, mouse, rat, bovine, canine, zebrafish, pig, and chicken transcription factor AP-2 gamma proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human TFAP2C

Application

Anti-TFAP2C polyclonal antibody is used to tag transcription factor AP-2 gamma for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transcription factor AP-2 gamma in extra-embryonic membrane development during embryo gestation.

Biochem/physiol Actions

TFAP2C is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.

Sequence

Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ještě jste nenalezli správný produkt?  

Vyzkoušejte náš produkt Nástroj pro výběr produktů.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Vyberte jednu z posledních verzí:

Osvědčení o analýze (COA)

Lot/Batch Number

Nevidíte správnou verzi?

Potřebujete-li konkrétní verzi, můžete vyhledat daný certifikát podle čísla dávky nebo čísla šarže.

Již tento produkt vlastníte?

Dokumenty související s produkty, které jste v minulosti zakoupili, byly za účelem usnadnění shromážděny ve vaší Knihovně dokumentů.

Navštívit knihovnu dokumentů

Min Zeng et al.
Korean circulation journal, 54(5), 233-252 (2024-04-24)
Myocardial ischemia-reperfusion injury (MIRI) refers to the damage of cardiac function caused by restoration of blood flow perfusion in ischemic myocardium. However, long non-coding RNA prostate androgen regulated transcript 1 (PART1)'s role in MIRI remain unclear. Immunofluorescence detected LC3 expression.
Daoyu Zhang et al.
Reproductive biomedicine online, 49(4), 103772-103772 (2024-05-16)
What is the role and mechanism of action of transcription factor AP-2 gamma (TFAP2C) in porcine early embryo development? TFAP2C siRNA were injected into porcine oocytes, which subsequently underwent IVF. Different stages of embryos were collected for RNA sequencing, quantitative

Náš tým vědeckých pracovníků má zkušenosti ve všech oblastech výzkumu, včetně přírodních věd, materiálových věd, chemické syntézy, chromatografie, analytiky a mnoha dalších..

Obraťte se na technický servis.