Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

SML3264

Sigma-Aldrich

Teduglutide trifluoroacetate

≥95% (HPLC)

Sinónimos:

ALX 0600, TFA salt, ALX-0600, TFA salt, ALX0600, TFA salt, HGDGSFSDEMNTILDNLAARDFINWLIQTKITD, TFA salt, His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp, TFA salt, [Gly2]-GLP-2 (human), TFA salt, [Gly2]-Glucagon-like peptide II (human), TFA salt, [Gly2]GLP-2 (human), TFA salt

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

UNSPSC Code:
12352200
NACRES:
NA.77

Quality Level

100

assay

≥95% (HPLC)

form

powder

storage condition

desiccated

color

white to off-white

storage temp.

−20°C

Biochem/physiol Actions

Teduglutide is a dipeptidyl peptidase IV (DPP IV)-resistant glucagon-like peptide 2 (GLP-2) analog with clinical efficacy for the treatment of gastrointestinal diseases, including short bowel syndrome (SBS), by promoting crypt cell proliferation, villus height expansion, and nutrient absorption. Experimental models of intestinal injury suggest that GLP-2 signaling exerts protective effects by increasing mesenteric blood flow, reducing intestinal inflammation, and facilitating structural and functional adaptation following major small bowel resection.

Storage Class

11 - Combustible Solids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

C Booth et al.
Cell proliferation, 37(6), 385-400 (2004-11-19)
Glucagon-like peptide-2 and its dipeptidyl peptidase (DP-IV) resistant analogue teduglutide are trophic for the gastrointestinal epithelium. Exposure increases villus height and crypt size and results in increased overall intestinal weight. As these effects may be mediated through stimulation of the
Domenico Nuzzo et al.
Neurobiology of disease, 121, 296-304 (2018-10-23)
Growing evidence suggests a link between obesity and neurodegeneration. The purpose of the present study was to explore the neuroprotective potential of glucagon-like peptide-2 (GLP-2) in the brain of high fat diet (HFD)-fed mice. Markers of inflammation and oxidative stress
Lucas Wauters et al.
Current opinion in pharmacology, 43, 118-123 (2018-10-03)
Dumping syndrome is a common and debilitating complication of upper gastrointestinal surgery. Accelerated gastric emptying and dysregulated secretion of gastrointestinal (GI) hormones are involved in its pathophysiology. Pasireotide, a novel somatostatin analogue, improved dumping in a phase-2 study. Preliminary data
Ferenc Sipos et al.
Journal of investigative surgery : the official journal of the Academy of Surgical Research, 31(3), 253-255 (2017-06-08)
Malabsorption is a major and common clinical characteristics of short bowel syndrome (SBS) and inflammatory bowel diseases (IBD). Traditional treatment opportunities have focused on decreasing malabsorptive losses via dietary modifications and antisecretory/antidiarrheal agents. However, novel therapeutic modalities aim to enhance
Pernille Wismann et al.
Physiology & behavior, 192, 72-81 (2018-03-16)
Analogues of several gastrointestinal peptide hormones have been developed into effective medicines for treatment of diseases such as type 2 diabetes mellitus (T2DM), obesity and short bowel syndrome (SBS). In this study, we aimed to explore whether the combination of
Ver todos los artículos relacionados

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico