SAB2100200

Anti-BACE1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-β-Site APP-cleaving enzyme 1, Anti-ASP2, Anti-BACE, Anti-FLJ90568, Anti-HSPC104
• MDL number: MFCD03096637
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 51 kDa
• species reactivity: rabbit, bovine, guinea pig, mouse, rat, horse, dog, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunofluorescence: suitable; immunohistochemistry: suitable; western blot: suitable
• UniProt accession no.: P56817
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... BACE1(23621)

Descripción

General description

β-site APP cleaving enzyme (BACE-1) is known as β-secretase. It consists of an N-terminal signal peptide (SP), a pro-peptide (Pro) domain, a catalytic domain, a transmembrane domain and a C-terminal tail.

BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

Immunogen

Synthetic peptide directed towards the N terminal region of human BACE1

Biochem/physiol Actions

β-site APP cleaving enzyme (BACE-1) acts as a rate-limiting enzyme of amyloid-β-peptide (Aβ). Overexpression of BACE-1 leads to increased β-secretase activity.

Sequence

Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable