HPA009650

Anti-ANXA6 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-67 kDa calelectrin antibody produced in rabbit, Anti-Annexin A6 antibody produced in rabbit, Anti-Annexin VI antibody produced in rabbit, Anti-CPB-II antibody produced in rabbit, Anti-Calphobindin-II antibody produced in rabbit, Anti-Chromobindin-20 antibody produced in rabbit, Anti-Lipocortin VI antibody produced in rabbit, Anti-P68 antibody produced in rabbit, Anti-P70 antibody produced in rabbit, Anti-Protein III antibody produced in rabbit
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA009650
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: rat, mouse, human
• validación mejorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• secuencia del inmunógeno: IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED
• Nº de acceso UniProt: P08133
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ANXA6(309)

Descripción

Descripción general

ANXA6 (annexin A6) belongs to a family of structurally highly conserved, Ca²⁺-regulated membrane-binding proteins called annexins. All annexin proteins are composed of a conserved Ca²⁺ and phospholipid-binding core and an N-terminal tail, which is different in each annexin. However, unlike other annexins this protein contains eight instead of four annexin repeats.

Inmunógeno

Annexin A6 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-ANXA6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

ANXA6 (annexin A6) plays an essential role in maintaining cellular homeostasis of cholesterol. It functions as a negative regulator of influenza A virus (IAV) replication. It therefore, has an antiviral activity attributed to its capability to influence cellular cholesterol pool. It interacts with membrane phospholipdis, F-actin and specific extracellular matrix (ECM) components. Thus, it might be involved in rapid plasma membrane reorganization, which results in cell adhesion and motility. The expression of this protein promotes anchorage-independent cell growth and loss of cell-cell or cell-ECM adhesion. Thus, it facilitates breast cancer tumorigenesis. This protein is thought to be involved in the assembly of detergent-resistant membrane microdomains (DRMs) found in Niemann-Pick type C (NPC) disease, as it is found anchored to the cholesterol storage compartment membranes in NPC disease fibroblasts.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86509

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)