05-23-2150

PACAP 38, Ovine

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

• Sinónimos: PACAP 38, Ovine, Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
• Fórmula empírica (notación de Hill): C₂₀₃H₃₃₁N₆₃O₅₃S
• Número de CAS: 137061-48-4
• Peso molecular: 4534.26
• Número MDL: MFCD00081800
• Código UNSPSC: 12352202
• NACRES: NA.77

Propiedades

• Nivel de calidad: 100
• Ensayo: ≥96% (HPLC)
• Formulario: solid
• fabricante / nombre comercial: Calbiochem^®
• condiciones de almacenamiento: OK to freeze; desiccated (hygroscopic)
• color: white to off-white
• solubilidad: 5% acetic acid: 1 mg/mL
• Condiciones de envío: ambient
• temp. de almacenamiento: −20°C

Descripción

Descripción general

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

Acciones bioquímicas o fisiológicas

Cell permeable: no

EC50 = 7 nM against adenylate cyclase

Primary Target
Adenylate cyclase

Product does not compete with ATP.

Reversible: no

Envase

Yes

Advertencia

Toxicity: Standard Handling (A)

Secuencia

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂

Reconstitución

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Otras notas

Kobayashi, H., et al. 1994. Brain Res.647, 145.
Chastre, E., et al. 1991. J. Biol. Chem.266, 21239.
Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun.166, 81.

Información legal

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable