Saltar al contenido
Merck
Todas las fotos(2)

Key Documents

SAB1400139

Sigma-Aldrich

Anti-IL6 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Sinónimos:

Anti-BSF2, Anti-HGF, Anti-HSF, Anti-IFNB2, Anti-IL6

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
western blot: 1 μg/mL

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IL6(3569)

General description

Human IL-6 (Interleukin-6) gene maps to chromosome 7p15. It is found to be mainly expressed in lymphoid and non-lymphoid cells, such as T-cells, B-cells, monocytes, fibroblasts, keratinocytes, endothelial cells and mesangium cells. It encodes a 184 amino acid protein that contains two potential N-glycosylation sites and four cysteine residues.

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)

Immunogen

IL6 (AAH15511, 1 a.a. ~ 212 a.a) full-length human protein.

Sequence
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Biochem/physiol Actions

IL-6 (Interleukin-6) is a proinflammatory cytokine that plays an important role in the maturation of B cells into antibody producing cells. It is also expressed by resting T-cells and induces IL-2 receptor and IL-2 production n mitogen-stimulated T cells and thymocytes. IL-6 functions in the activation and proliferation of T-cells. It participates in hematopoiesis by activating hematopoietic stem cells at the G0 stage to enter into the G1 phase. Increased levels of IL-6 and C-reactive protein have been observed in type-2 diabetes mellitus.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Optional

Referencia del producto
Descripción
Precios

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

The biology of interleukin-6.
Hirano T.
Interleukins : molecular biology and immunology, 51, 153-180 (1992)
A D Pradhan et al.
JAMA, 286(3), 327-334 (2001-07-24)
Inflammation is hypothesized to play a role in development of type 2 diabetes mellitus (DM); however, clinical data addressing this issue are limited. To determine whether elevated levels of the inflammatory markers interleukin 6 (IL-6) and C-reactive protein (CRP) are

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico