MSQC23

SILu^™MAb Trastuzumab Stable-Isotope Labeled Monoclonal Antibody

recombinant, expressed in CHO cells

• Sinónimos: Mass spectrometry standard, Trastuzumab, Stable isotope labelled Trastuzumab
• UNSPSC Code: 12352203
• NACRES: NA.84

Propiedades

• recombinant: expressed in CHO cells
• assay: ≥90% (SDS-PAGE)
• form: solid
• suitability: suitable for mass spectrometry
• shipped in: wet ice
• storage temp.: −20°C

Descripción

General description

SILu^™MAb Trastuzumab (MSQC23) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [₁₃C⁶, ₁₅N⁴]-Arginine and [₁₃C⁶, ₁₅N²]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Trastuzumab in human serum.

SILu^™MAb Trastuzumab is for R&D use only. Not for drug, household, or other uses.

MRM settings provided (XLS File)

Sequence

SILu^™MAb Trastuzumab Heavy Chain:
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILu^™MAb Trastuzumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Información de seguridad

• Storage Class: 11 - Combustible Solids
• wgk_germany: WGK 3