HPA025235
Anti-VANGL1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinónimos:
Anti-LPP2, Anti-Loop-tail protein 2 homolog, Anti-Strabismus 2, Anti-Van Gogh-like protein 1, Anti-Vang-like protein 1
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Línea del producto
Prestige Antibodies® Powered by Atlas Antibodies
Formulario
buffered aqueous glycerol solution
reactividad de especies
human
validación mejorada
recombinant expression
RNAi knockdown
Learn more about Antibody Enhanced Validation
técnicas
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
secuencia del inmunógeno
DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... VANGL1(81839)
Descripción general
The gene VANGL1 (vang-like protein 1) is mapped to human chromosome 1p13. The encoded protein is a transmembrane protein and a component of the Wnt-PCP (planar cell polarity) pathway. The VANGL1 protein can interact with planar cell polarity (PCP) core proteins Disheveled, Prickle, and Frizzled, KAI1 (metastasis suppressor Kangai-1) protein and ITF (intestinal trefoil factor) protein.
Inmunógeno
Vang-like protein 1 recombinant protein epitope signature tag (PrEST)
Aplicación
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-VANGL1 antibody produced in rabbit has been used for immunohistochemsitry and immunofluorescence.
Anti-VANGL1 antibody produced in rabbit has been used for immunohistochemsitry and immunofluorescence.
Anti-VANGL1 antibody produced in rabbit has been used in western blot and immunostaining.
Acciones bioquímicas o fisiológicas
VANGL1 (vang-like protein 1) is associated with tumor progression in various cancers. In colorectal cancer, it enhances the angiogenesis. In mouse colon cells, overexpression of the VANGL1 gene causes tumorigenicity, invasiveness and adhesion to fibronectin. VANGL1 is upregulated in colon, laryngeal, oral cavity squamous, gastric and hepatocellular cancer tissues. VANGL1 is a planar cell polarity protein. It plays a significant role in embryogenesis and is required for normal embryonic development.
Características y beneficios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligadura / enlace
Corresponding Antigen APREST73163
Forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Información legal
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Katsura Minegishi et al.
Developmental cell, 40(5), 439-452 (2017-03-16)
Polarization of node cells along the anterior-posterior axis of mouse embryos is responsible for left-right symmetry breaking. How node cells become polarized has remained unknown, however. Wnt5a and Wnt5b are expressed posteriorly relative to the node, whereas genes for Sfrp
Renata Prunskaite-Hyyryläinen et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 28(4), 1568-1581 (2013-12-29)
Wnt4 is a key signal that channels the developmental fate of the indifferent mammalian gonad toward the ovary, but whether Wnt4 has later roles during ovary development remains unknown. To investigate this, we inactivated the Wnt4 gene by crossing Amhr2Cre
Eszter K Vladar et al.
Methods in cell biology, 127, 37-54 (2015-04-04)
The concerted movement of cilia propels inhaled contaminants out of the lungs, safeguarding the respiratory system from toxins, pathogens, pollutants, and allergens. Motile cilia on the multiciliated cells (MCCs) of the airway epithelium are physically oriented along the tissue axis
Gokhan Ozan Cetin et al.
Genetic testing and molecular biomarkers, 19(6), 283-287 (2015-04-16)
The Wnt planar cell polarity (PCP) pathway is one of the Wnt pathways which plays a critical role in cell proliferation and fate. The VANGL1 protein is one of Wnt-PCP pathway components. It is known that Wnt-PCP pathway has major
Michelle L Stoller et al.
Developmental biology, 437(1), 17-26 (2018-03-07)
The organization of polarized stereociliary bundles is critical for the function of the inner ear sensory receptor hair cells that detect sound and motion, and these cells present a striking example of Planar Cell Polarity (PCP); the coordinated orientation of
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico