Saltar al contenido
Merck
Todas las fotos(8)

Documentos clave

HPA014670

Sigma-Aldrich

Anti-ZDHHC5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-DHHC-5, Anti-Palmitoyltransferase ZDHHC5, probable, Anti-Zinc finger DHHC domain-containing protein 5, Anti-Zinc finger protein 375

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

secuencia del inmunógeno

DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPE

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ZDHHC5(25921)

Descripción general

ZDHHC5 (zinc finger, DHHC-type containing 5) is a member of the family of integral membrane proteins called DHHC (Asp-His-His-Cys). This family has its palmitoyl acyltransferases (PAT) activity conserved through Saccharomyces cerevisiae to mammals. This family has 23 identified members in humans, out of which 17 exhibit PAT activity. ZDHHC5 protein and the mRNA are highly expressed in neurons. It is found in dendrites, in dendritic shafts, and rarely in dendritic spine. ZDHHC5 gene is localized to human chromosome 11. It has the characteristic DHHC domain, and has a highly elongated C-terminal. This C-terminal contains PDZ-binding domain, which is specific for type II PDZ-ligand

Inmunógeno

Palmitoyltransferase ZDHHC5, probable recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-ZDHHC5 antibody produced in rabbit has been used in:
  • microarray
  • immunofluorescence
  • immunoprecipitation
  • coimmunoprecipitation

Anti-ZDHHC5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

ZDHHC5 (zinc finger, DHHC-type containing 5) is a palmitoyl acyltransferase (PAT), which has its three cysteine residues S-acylated, within the CCX7-13C(S/T) motif. It is responsible for the palmitoylation of somatostatin receptor subtype 5 (SSTR5), which is a GPCR (G-protein coupled receptor). It might also be involved in the palmitoylation of other GPCRs, especially in the brain. This might explain its role in learning, memory and synaptic function. Also this protein is highly expressed in neurons, and might have an essential regulatory role in the neurons. Suppression of ZDHHC5 in mice, shows reduced learning capabilities, and this protein is also linked with neuropsychiatric disorders. This gene locus is also associated with bipolar disorder. It also palmitoylates GRIP1 (Glutamate receptor-interacting protein 1)b protein, and targets it to the endosomes of dendritic cells. This way it controls the trafficking of AMPA-R (α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor).

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST72922

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

A ZDHHC5-GOLGA7 Protein Acyltransferase Complex Promotes Nonapoptotic Cell Death
Ko PJ, et al.
Cell Chemical Biology (2019)
Yusuke Ohno et al.
Molecular biology of the cell, 23(23), 4543-4551 (2012-10-05)
Palmitoylation plays important roles in the regulation of protein localization, stability, and activity. The protein acyltransferases (PATs) have a common DHHC Cys-rich domain. Twenty-three DHHC proteins have been identified in humans. However, it is unclear whether all of these DHHC
Systematic siRNA screen unmasks NSCLC growth dependence by palmitoyltransferase DHHC5
Tian H, et al.
Molecular Cancer Research, 13(4), 784-794 (2015)
Tarja Kokkola et al.
FEBS letters, 585(17), 2665-2670 (2011-08-09)
Many G-protein coupled receptors are palmitoylated in their C-terminal, intracellular regions. So far no enzymes responsible for this modification have been described. We identified an interaction of the membrane proximal helix 8 of somatostatin receptor 5 (SSTR5) with the N-terminal
Yi Li et al.
The Journal of biological chemistry, 287(1), 523-530 (2011-11-15)
Post-translational palmitoylation of intracellular proteins is mediated by protein palmitoyltransferases belonging to the DHHC family, which share a common catalytic Asp-His-His-Cys (DHHC) motif. Several members have been implicated in neuronal development, neurotransmission, and synaptic plasticity. We previously observed that mice

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico