Saltar al contenido
Merck

HPA002279

Sigma-Aldrich

Anti-PLVAP antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

PLVAP Antibody - Anti-PLVAP antibody produced in rabbit, Plvap Antibody, Anti-Fenestrated endothelial-linked structure protein antibody produced in rabbit, Anti-PV-1 antibody produced in rabbit, Anti-Plasmalemma vesicle protein 1 antibody produced in rabbit, Anti-Plasmalemma vesicle-associated protein antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnicas

immunohistochemistry: 1:500-1:1000

secuencia del inmunógeno

KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PLVAP(83483)

Descripción general

Plasmalemma vesicle associated protein (PLVAP) is a rod-like type II membrane amino-glycosylated glycoprotein with molecular mass of 60kDa. It consists of a short intracellular tail and a long extracellular domain. There are four glycosylation sites, a proline-rich region and two large coiled-coil domains. In culture and in situ state it exists as homodimers.
The PLVAP gene is mapped to human chromosome 19p13.11.

Inmunógeno

Plasmalemma vesicle-associated protein recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-PLVAP antibody produced in rabbit has been used in immunohistochemistry.

Acciones bioquímicas o fisiológicas

PLVAP (plasmalemma vesicle associated protein) is an endothelial-specific integral membrane glycoprotein involved in the biogenesis and regulation of stomatal diaphragms of caveolae, transendothelial channels (TECs), vesiculovacuolar organelles (VVOs) and diaphragms of endothelial fenestrae. It is an endothelium-specific protein. It forms the viatl radial fibrils, a key structural component, for the stomatal diaphragm (SD) and fenestral diaphragm (FD). Studies have suggested that PLVAP dimers form fibrils of the diaphragms with microvascular permeability.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST85160

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Replication of caucasian loci associated with osteoporosis-related traits in East Asians
Kim BJ, et al.
Journal of bone metabolism, 23(4), 233-242 (2016)
Targeted drug delivery via caveolae-associated protein PV1 improves lung fibrosis
Marchetti GM, et al.
Communications biology, 2(1), 92-92 (2019)
Medulloblastoma genotype dictates blood brain barrier phenotype
Phoenix TN, et al.
Cancer Cell, 29(4), 508-522 (2016)
Radu V Stan
American journal of physiology. Heart and circulatory physiology, 286(4), H1347-H1353 (2003-11-25)
Several of the endothelium-specific structures that have been involved in microvascular permeability [such as caveolae, transendothelial channels (TECs), vesiculovacuolar organelles (VVOs), and fenestrae] can be provided with either a stomatal or fenestral diaphragm. In the case of fenestrae, the diaphragm
Fan Yang et al.
Frontiers in oncology, 11, 683367-683367 (2021-07-06)
Glioblastoma (GBM) is the most aggressive and lethal type of brain tumors. Magnetic resonance imaging (MRI) has been commonly used for GBM diagnosis. Contrast enhancement (CE) on T1-weighted sequences are presented in nearly all GBM as a result of high

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico