Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV48378

Sigma-Aldrich

Anti-OCIAD1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Asrij, Anti-FLJ20455, Anti-MGC111072, Anti-OCIA, Anti-OCIA domain containing 1, Anti-TPA018

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

27 kDa

reactividad de especies

guinea pig, horse, human, rat

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... OCIAD1(54940)

Descripción general

OCIAD1 codes for an OCIA domain-containing protein that is involved in ovarian cancer cell adhesion. Its expression in differentiated thyroid carcinoma has been correlated to metastasis risk.
Rabbit Anti-OCIAD1 antibody recognizes canine, bovine, human, mouse, and rat OCIAD1.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human OCIAD1

Aplicación

Rabbit Anti-OCIAD1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Acciones bioquímicas o fisiológicas

OCIAD1 belongs to the OCIAD1 family. It contains 1 OCIA domain. OCIAD1 is over-expressed in metastatic ovarian cancer. Effect of OCIAD1 on cell adhesion may be related to its function in ovarian cancer. Possibily, OCIAD1 may play a role in tumor metastasis.

Secuencia

Synthetic peptide located within the following region: QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Saubhik Sengupta et al.
Gynecologic oncology, 109(2), 226-233 (2008-03-11)
To identify proteins unique to metastatic ovarian cancer and test their potential involvement in cell adhesion. We purified plasma membrane from paired metastatic and primary tumor tissues from patients with stage IIIC ovarian cancer. Membrane proteins unique to metastases were
An-Hang Yang et al.
Journal of clinical pathology, 65(3), 206-212 (2011-11-15)
The biomarkers representing the metastatic potential of well-differentiated thyroid carcinoma remain to be established. A study was undertaken to find whether the expression status of neural cell adhesion molecule (NCAM) and/or ovarian cancer immunoreactive antigen domain containing 1 (OCIAD1) is

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico