WH0005325M1

Monoclonal Anti-PLAGL1 antibody produced in mouse

clone 1E2, ascites fluid

• Sinonimo/i: Anti-DKFZp781P1017, Anti-LOT1, Anti-ZAC, Anti-ZAC1, Anti-pleiomorphic adenoma gene-like 1
• Codice UNSPSC: 12352203
• NACRES: NA.43

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: ascites fluid
• Tipo di anticorpo: primary antibodies
• Clone: 1E2, monoclonal
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotipo: IgMκ
• N° accesso Genebanck: NM_002656
• N° accesso UniProt: Q9UM63
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PLAGL1(5325)

Descrizione

Descrizione generale

This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Many transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)

Immunogeno

PLAGL1 (NP_002647.2, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL

Azioni biochim/fisiol

The maternally-imprinted gene, PLAGL1 (pleiomorphic adenoma-like protein 1), functions as an oncogene as well as a tumor suppressor depending on the cell context. It has been found to exhibit anti-proliferative properties and regulate apoptosis and cell-cycle arrest via p53.

Stato fisico

Solution

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)