Passa al contenuto
Merck
Tutte le immagini(4)

Key Documents

WH0002940M1

Sigma-Aldrich

Monoclonal Anti-GSTA3 antibody produced in mouse

clone 1F11, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-GSTA33, Anti-GTA3, Anti-MGC22232, Anti-glutathione S-transferase A3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

1F11, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... GSTA3(2940)

Descrizione generale

Glutathione S-transferase alpha 3 (GSTA3) has two isoforms, that is cytosolic and membrane-bound, which are encoded by two distinct supergene families. These enzymes are involved in cellular defence against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyses the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. (provided by RefSeq)GSTA3 is a adipocyte differentiation-associated protein. It is expressed in steroidogenic tissues. The protein belongs to the family of detoxifying and cytoprotective enzymes.

Immunogeno

GSTA3 (AAH20619, 1 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

Azioni biochim/fisiol

Glutathione S-transferase alpha 3 (GSTA3) is involved in the metabolism of electrophilic xenobiotic and endobiotic toxic compounds. It may be used as a target for prescribing medication in steroid hormone-dependent diseases. This protein is related to diseases associated with oxidation-regulating proteins. It is used as a therapeutic target for renal interstitial fibrosis (RIF).

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Expression of the murine glutathione S-transferase ?(GSTA3) subunit is markedly induced during adipocyte differentiation: activation of the GSTA3 gene promoter by the pro-adipogenic eicosanoid 15-deoxy-?12, 14-prostaglandin J 2
Jowsey IR, et al.
Biochemical and Biophysical Research Communications, 312(4), 1226-1235 (2003)
Glutathione S-transferase polymorphisms: cancer incidence and therapy
McIlwain CC, et al.
Oncogene, 25(11), 1639-1639 (2006)
GSTA3 attenuates renal interstitial fibrosis by inhibiting TGF-beta-induced tubular epithelial-mesenchymal transition and fibronectin expression
Xiao Y, et al.
PLoS ONE, 11(9), e0160855-e0160855 (2016)
Isomerization of ?5-androstene-3, 17-dione into ?4-androstene-3, 17-dione catalyzed by human glutathione transferase A3-3: a computational study identifies a dual role for glutathione
Dourado DF, et al.
The Journal of Physical Chemistry A, 118(31), 5790-5800 (2014)
Françoise Raffalli-Mathieu et al.
The Biochemical journal, 414(1), 103-109 (2008-04-23)
hGSTA3-3 (human Alpha-class glutathione transferase 3-3) efficiently catalyses steroid Delta(5)-Delta(4) double-bond isomerization in vitro, using glutathione as a cofactor. This chemical transformation is an obligatory reaction in the biosynthesis of steroid hormones and follows the oxidation of 3beta-hydroxysteroids catalysed by

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.