SAB5702921

Anti-GAD1(GAD67) Antibody

rabbit monoclonal, 4I8S8

• Sinonimo/i: CPSQ1, GAD, SCP
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Nome del prodotto: Anti-GAD67/GAD1 Antibody, clone 4I8S8, Rabbit Monoclonal,
• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 4I8S8, monoclonal
• Stato: liquid
• PM: 70 kDa
• Reattività contro le specie: rat, rat, human
• Concentrazione: 1.10 mg/mL
• tecniche: western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFA
• N° accesso UniProt: Q99259
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... GAD1(2571)

Descrizione

Descrizione generale

This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form. [provided by RefSeq, Jul 2008]

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GAD67/GAD1 (Q99259).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable