Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

SAB1401583

Sigma-Aldrich

Monoclonal Anti-STAB1 antibody produced in mouse

clone 4G9, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

CLEVER-1, FEEL-1, FELE-1, FEX1, KIAA0246, STAB-1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μG
CHF 502.00

CHF 502.00


Spedizione prevista il26 maggio 2025



Scegli un formato

Cambia visualizzazione
100 μG
CHF 502.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 502.00


Spedizione prevista il26 maggio 2025


Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

4G9, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

capture ELISA: suitable
immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... STAB1(23166)

Descrizione generale

Stabilin 1 (STAB1) gene encodes a large, transmembrane receptor protein which may function in angiogenesis, lymphocyte homing, cell adhesion, or receptor scavenging. The protein contains 7 fasciclin, 16 epidermal growth factor (EGF)-like, and 2 laminin-type EGF-like domains as well as a C-type lectin-like hyaluronan-binding Link module. The protein is primarily expressed on sinusoidal endothelial cells of liver, spleen, and lymph node. The receptor has been shown to endocytose ligands such as low density lipoprotein, Gram-positive and Gram-negative bacteria, and advanced glycosylation end products. Supporting its possible role as a scavenger receptor, the protein rapidly cycles between the plasma membrane and early endosomes. (provided by RefSeq).
Stabilin 1 (STAB1) is expressed on tissue macrophages and sinusoidal endothelial cells. It is a type-1 transmembrane receptor. STAB1 is expressed in alternatively activated macrophages. STAB1 gene is located on human chromosome 3p21.1.

Immunogeno

STAB1 (NP_055951, 1804 a.a. ~ 1902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ

Azioni biochim/fisiol

Stabilin 1 (STAB1) maintains tissue homeostasis and prevents autoimmunity. STAB1 mediates endocytic and phagocytic clearance of undesirable internal components. STAB1 is an immunosuppressive molecule and reduces proinflammatory reactions in vivo.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Multifunctional receptor stabilin-1 in homeostasis and disease
Kzhyshkowska J, et al.
TheScientificWorldJournal, 10(1) (2010)
Stabilin-1 mediates phosphatidylserine-dependent clearance of cell corpses in alternatively activated macrophages
Park S, et al.
Journal of Cell Science, 122(18) (2009)
Monocyte Stabilin-1 suppresses the activation of TH1 lymphocytes
Palani S, et al.
Journal of Immunology, 1500257-1500257 (2015)
Stabilin-1, a homeostatic scavenger receptor with multiple functions
Kzhyshkowska J, et al.
Journal of Cellular and Molecular Medicine, 10(3) (2006)
Allelic expression analysis of the osteoarthritis susceptibility locus that maps to chromosome 3p21 reveals cis-acting eQTLs at GNL3 and SPCS1
Gee F, et al.
BMC Medical Genetics, 15(1), 53-53 (2014)

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.