Passa al contenuto
Merck
Tutte le immagini(2)

Documenti

MSQC18

Sigma-Aldrich

SILu™Lite SigmaMAb Cetuximab Monoclonal Antibody

recombinant, expressed in CHO cells

Sinonimo/i:

Mass spectrometry standard, Cetuximab

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
41105331
NACRES:
NA.41

Ricombinante

expressed in CHO cells

Saggio

≥90% (SDS-PAGE)

Forma fisica

solid

Compatibilità

suitable for mass spectrometry

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Descrizione generale

SigmaMAb Cetuximab (MSQC18) was designed to be a standard for the analysis of Cetuximab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Cetuximab (MSQC19).

SigmaMAb Cetuximab is for R&D use only. Not for drug, household, or other uses.

Applicazioni

SILu™ Lite SigmaMAb Cetuximab Monoclonal Antibody has been used in isoluminol enhanced chemiluminescence assay to measure the reactive oxygen species (ROS) production from monocytes.

Sequenza

SigmaMab Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SigmaMab Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Note legali

SILu is a trademark of Sigma-Aldrich Co. LLC

Codice della classe di stoccaggio

11 - Combustible Solids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Sachin Surve et al.
The Journal of cell biology, 220(11) (2021-09-14)
The subcellular localization of RAS GTPases defines the operational compartment of the EGFR-ERK1/2 signaling pathway within cells. Hence, we used live-cell imaging to demonstrate that endogenous KRAS and NRAS tagged with mNeonGreen are predominantly localized to the plasma membrane. NRAS
Ali A Akhiani et al.
Cancer immunology research, 8(12), 1532-1541 (2020-09-25)
The phosphatidylinositol-4,5-bisphosphate-3 kinase-δ (PI3Kδ) inhibitor idelalisib, used alone or in combination with anti-CD20, is clinically efficacious in B-cell lymphoma and chronic lymphocytic leukemia (CLL) by promoting apoptosis of malignant B cells. PI3K regulates the formation of reactive oxygen species (ROS)

Articoli

Monoclonal Antibody Titer Determination Using a Chromolith® WP 300 Protein A Wide Pore Monolithic Silica HPLC Column

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Antibody Aggregates & Fragments Analysis Workflow

Characterize mAb monomers, aggregates, and fragments using SEC-UV workflow with Zenix® and Zenix®-C SEC columns.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.