HPA024223
Anti-MYO10 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinonimo/i:
Anti-Myosin-X, Anti-Unconventional myosin-10
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Scegli un formato
100 μL
CHF 481.00
CHF 481.00
Check Cart for Availability
Scegli un formato
Cambia visualizzazione
100 μL
CHF 481.00
About This Item
CHF 481.00
Check Cart for Availability
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Nome Commerciale
Prestige Antibodies® Powered by Atlas Antibodies
Stato
buffered aqueous glycerol solution
Reattività contro le specie
mouse, human
tecniche
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
Sequenza immunogenica
QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSA
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... MYO10(4651)
Descrizione generale
The gene MYO10 (unconventional myosin-10) is mapped to human chromosome 5p15.1. It belongs to the MyTH4-FERM (myosin tail homology 4-band 4.1, ezrin, radixin, moesin, or MF) family of myosins. The protein has a myosin motor domain, a neck consisting of three IQ motifs and a tail region with three pleckstrin homology domains.
Immunogeno
Myosin-X recombinant protein epitope signature tag (PrEST)
Applicazioni
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MYO10 antibody produced in rabbit has ben used in western blotting and immunofluorescence.[1][2]
Anti-MYO10 antibody produced in rabbit has ben used in western blotting and immunofluorescence.[1][2]
Azioni biochim/fisiol
MYO10 (unconventional myosin-10) is a microtubule-binding myosin. It is essential for centrosome positioning. It is a target gene for microRNA miR-340. In breast cancer, miR-340 inhibits invasion by silencing MYO10, which is responsible for aggressiveness and metastasis in breast cancer. The MYO10 gene is also a direct target of miR-124. Silencing of this gene suppresses cell invasion and metastasis in node-positive non-small cell lung cancer. MYO10 also plays a significant role in wound healing, invadopodia formation and angiogenesis.
Caratteristiche e vantaggi
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST85234
Stato fisico
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Note legali
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
John Caltagarone et al.
Molecular and cellular neurosciences, 68, 120-130 (2015-05-06)
Dopamine transporter (DAT, SLC6A3) controls dopamine (DA) neurotransmission by mediating re-uptake of extracellular DA into DA neurons. DA uptake depends on the amount of DAT at the cell surface, and is therefore regulated by DAT subcellular distribution. Hence we used
NF-?B-mediated miR-124 suppresses metastasis of non-small-cell lung cancer by targeting MYO10.
Sun Y, et al.
Oncotarget, 6, 8244-8254 (2015)
Jeffrey Kroon et al.
Journal of immunology (Baltimore, Md. : 1950), 200(5), 1790-1801 (2018-02-02)
Leukocyte transendothelial migration is key to inflammation. Leukocytes first start rolling over the inflamed endothelium, followed by firmly adhering to it. Under inflammatory conditions, endothelial cells express small finger-like protrusions that stick out into the lumen. The function and regulation
Direct Microtubule-Binding by Myosin-10 Orients Centrosomes toward Retraction Fibers and Subcortical Actin Clouds.
Kwon M, et al.
Developmental Cell, 34, 323-337 (2015)
Downregulation of ZIP kinase is associated with tumor invasion, metastasis and poor prognosis in gastric cancer.
Bi J, et al.
International Journal of Cancer. Journal International Du Cancer, 124, 1587-1593 (2009)
Active Filters
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.
