Passa al contenuto
Merck
Tutte le immagini(7)

Documenti fondamentali

HPA005466

Sigma-Aldrich

Anti-MYBBP1A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-FLJ37886, Anti-MYB binding protein (P160) 1a, Anti-P160, Anti-PAP2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 556.00

CHF 556.00


Check Cart for Availability


Scegli un formato

Cambia visualizzazione
100 μL
CHF 556.00

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

CHF 556.00


Check Cart for Availability

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Sequenza immunogenica

EDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVG

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... MYBBP1A(10514)

Descrizione generale

Myb-binding protein 1a (MYBBP1A) is a transcriptional co-regulator, which was originally identified as the protein which interacts with the proto-oncogene c-Myb. It is largely localized to the nucleolus, as it contains basic amino-acid repeats at its C-terminal. This protein weighs 160kDa and is expressed ubiquitously. Processing of the C-terminal nucleolar signal peptide produces two N-terminal forms of 140kDa and 67kDa. These forms are found in the nucleoplasm. MYBBP1A is located in the chromosomal region 17p13.3.

Immunogeno

MYB binding protein (P160) 1a recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Azioni biochim/fisiol

Myb-binding protein 1a (MYBBP1A) regulates essential functions such as cell division, proliferation and apoptosis. It binds to NFκB via its RelA/p65 subunit, and prevents it trans-activating capacity. It binds to multiple transcription factors, such as PPARγ co-activator 1α, and inhibits them. This protein also forms a part of the Ret-CoR co-repressor complex. It activates the aryl hydrocarbon receptor (AhR). It induces apoptosis by preventing Mdm2 mediated degradation of p53. MYBBP1A maintains the silent state of rDNA and negatively regulates the epigenetic state of silent rDNA. It also negatively regulates the expression of rRNA. MYBBP1A prevents breast cancer tumorigenesis and controls the metastasis as well as proliferation of head and neck squamous cell carcinoma cells.[1]

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86952

Stato fisico

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Gustavo A Acuña Sanhueza et al.
BMC cancer, 12, 72-72 (2012-02-22)
Head and neck squamous cell carcinoma (HNSCC) is one of the most prevalent and lethal cancers worldwide and mortality mostly results from loco-regional recurrence and metastasis. Despite its significance, our knowledge on molecular, cellular and environmental mechanisms that drive disease
R Keough et al.
Genomics, 62(3), 483-489 (2000-01-25)
We have previously isolated and characterized murine MYB binding protein (p160) 1a, a protein that specifically interacts with the leucine zipper motif within the negative regulatory domain of the c-Myb proto-oncoprotein. We now describe the molecular cloning of the human
Tetsuro Komatsu et al.
Traffic (Copenhagen, Denmark), 17(11), 1168-1180 (2016-10-27)
In adenoviral virions, the genome is organized into a chromatin-like structure by viral basic core proteins. Consequently viral DNAs must be replicated, chromatinized and packed into progeny virions in infected cells. Although viral DNA replication centers can be visualized by
Bertrand Chin-Ming Tan et al.
Journal of biomedical science, 19, 57-57 (2012-06-13)
Transcription of the ribosomal RNA gene repeats by Pol I occurs in the nucleolus and is a fundamental step in ribosome biogenesis and protein translation. Due to tight coordination between ribosome biogenesis and cell proliferation, transcription of rRNA and stable
Silvia Mori et al.
PloS one, 7(10), e39723-e39723 (2012-10-12)
MYBBP1A is a predominantly nucleolar transcriptional regulator involved in rDNA synthesis and p53 activation via acetylation. However little further information is available as to its function. Here we report that MYBBP1A is developmentally essential in the mouse prior to blastocyst

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.