Passa al contenuto
Merck
Tutte le immagini(8)

Documenti fondamentali

HPA004246

Sigma-Aldrich

Anti-PRKAG2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-5′-AMP-activated protein kinase subunit γ-2 antibody produced in rabbit, Anti-AMPK γ-2 chain antibody produced in rabbit, Anti-AMPK γ2 antibody produced in rabbit, Anti-H91620p antibody produced in rabbit

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 556.00

CHF 556.00


Check Cart for Availability


Scegli un formato

Cambia visualizzazione
100 μL
CHF 556.00

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

CHF 556.00


Check Cart for Availability

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

rat, mouse, human

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Sequenza immunogenica

STPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHK

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PRKAG2(51422)

Descrizione generale

PRKAG2 (protein kinase, AMP-activated, γ2 non-catalytic subunit) is a non-catalytic regulatory subunit of heterotrimeric AMP-activated protein kinase (AMPK), involved in the energy metabolism. It is predominantly present in all subcellular fractions, including the nuclei.

Immunogeno

5′-AMP-activated protein kinase subunit γ-2 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-PRKAG2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

PRKAG2 (protein kinase, AMP-activated, γ2 non-catalytic subunit) acts as a sensor of cellular energy status that is controlled by AMP (positively) and ATP (negatively). In normal state CBS domains from AMP-activated protein kinase can bind AMP, ATP, or S-adenosyl methionine. But in mutated condition, it cannot bind. As a result, it leads to hereditary diseases. Its major activity is involved in the regulation of energy homeostasis. It plays an important role in correcting of cell division and chromosome segregation during mitosis. Mutation in PRKAG2 causes Wolff-Parkinson-White (WPW) syndrome, a rare autosomal dominant inheritance disease.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86734

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Katalin Pinter et al.
Cell cycle (Georgetown, Tex.), 11(5), 917-921 (2012-02-16)
AMP-activated protein kinase has been shown to be a key regulator of energy homeostasis; it has also been identified as a tumor suppressor and is required for correct cell division and chromosome segregation during mitosis. The enzyme is a heterotrimer
Li-Ping Zhang et al.
Journal of electrocardiology, 44(4), 483-486 (2010-04-13)
Familial appearance of Wolff-Parkinson-White (WPW) syndrome is rare and displays an autosomal dominant inheritance. Here we report a Chinese kindred of WPW syndrome whose unique clinical features consist of a high risk of sudden cardiac death due to atrial fibrillation
Tània Martiáñez et al.
The Journal of biological chemistry, 284(36), 23902-23911 (2009-07-03)
Ultrasensitivity, hysteresis (a form of biochemical memory), and all-or-none (digital) responses are important signaling properties for the control of irreversible processes and are well characterized in the c-Jun N-terminal kinase (JNK) system using Xenopus oocytes. Our aim was to study

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.