AV43838

Anti-SLC7A1 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-ATRC1, Anti-CAT-1, Anti-ERR, Anti-HCAT1, Anti-REC1L, Anti-Solute carrier family 7 (cationic amino acid transporter, y⁺ system), member 1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 68 kDa
• Reattività contro le specie: human, rabbit, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_003036
• N° accesso UniProt: P30825
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SLC7A1(6541)

Descrizione

Descrizione generale

Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1/ high affinity cationic amino acid transporter 1 (SLC7A1, ATRC1, CAT-1, ERR, REC1L) is a y+ system cationic amino acid transporter family member that supports arginine uptake and nitric oxide (NO) production. Mouse CAT-1 is a viral receptor for ecotropic murine leukemia virus (MLV) (eMLV), making it a model for study of retrovirus infection mechanisms and pathogenesis.

Specificità

Anti-SLC7A1 polyclonal antibody reacts with human and pig solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human SLC7A1

Applicazioni

Anti-SLC7A1 polyclonal antibody is used to tag Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 in cationic amino acid uptake and retrovirus infection mechanisms and pathogenesis.

Azioni biochim/fisiol

SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.

Sequenza

Synthetic peptide located within the following region: LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable