Passa al contenuto
Merck
Tutte le immagini(3)

Documenti

AV31369

Sigma-Aldrich

Anti-KLF9 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Kruppel-like factor 9

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(3)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

27 kDa

Reattività contro le specie

rat, rabbit, horse, mouse, human, bovine, guinea pig

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_001197

N° accesso UniProt

Q13886

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KLF9(687)

Categorie correlate

Descrizione generale

Kruppel-like factor 9 (KLF9) is a transcription factor that regulates several functions such as central nervous systems (CNS) development, villus cell movement, intestinal cell proliferation, and PPARγ-mediated adipocyte differentiation. Furthermore, KLF9 also regulates the differentiation, adhesion and growth of endometrial cells and has been implicated in endometrial carcinoma.
Rabbit Anti-KLF9 antibody recognizes pig, bovine, human, mouse, and rat KLF9.

Immunogeno

Synthetic peptide directed towards the N-terminal region of Human KLF9

Applicazioni

Rabbit Anti-KLF9 antibody is suitable for use in western blot (1.0μg/ml) and IHC (4-8μg/ml) applications.

Azioni biochim/fisiol

KLF9 is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription.

Sequenza

Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Frank A Simmen et al.
Reproductive biology and endocrinology : RB&E, 6, 41-41 (2008-09-12)
Krüppel-like factor 9 (KLF9) is a transcriptional regulator of uterine endometrial cell proliferation, adhesion and differentiation; processes essential for pregnancy success and which are subverted during tumorigenesis. The network of endometrial genes controlled by KLF9 is largely unknown. Over-expression of
H Pei et al.
Cell death and differentiation, 18(2), 315-327 (2010-08-21)
Krüppel-like factors (KLFs) as a family of zinc-finger transcription factors involve in the regulation of many physiological processes. In these studies, KLF9 was characterized for its role in adipogenesis. The expression of KLF9 was markedly upregulated during the middle stage

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.