WH0081631M1

Anti-MAP1LC3B Antibody

mouse monoclonal, 4E11

• Synonyme(s) : Anti-MAP1A/1BLC3, Anti-microtubule-associated protein 1 light chain 3 beta
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Nom du produit: Monoclonal Anti-MAP1LC3B antibody produced in mouse, clone 4E11, purified immunoglobulin, buffered aqueous solution
• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 4E11, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable
• Isotype: IgG2bκ
• Numéro d'accès GenBank: NM_022818
• Numéro d'accès UniProt: Q9GZQ8
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MAP1LC3B(81631)

Description

Description générale

The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. (provided by RefSeq)

Immunogène

MAP1LC3B (NP_073729, 1 a.a. ~ 71 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): nwg
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)